LL-37

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and biofilms. Beyond direct pathogen killing, LL-37 has immunomodulatory, wound-healing, and angiogenic properties. It is naturally produced by epithelial cells and immune cells as part of innate immunity, with vitamin D stimulating its endogenous production. A randomized controlled trial has evaluated topical LL-37 in venous leg ulcers.

Category: Antimicrobial / Immune. Evidence rating: D (animal/preclinical only).

Clinical status: Investigational / Limited clinical trial data (topical wound healing RCT exists)

LL-37 (C120H232N42O38) carries a net positive charge (+6) that binds negatively charged bacterial membranes, creating transmembrane pores causing cell lysis. It also has anti-biofilm activity. Immunomodulatory functions include both pro- and anti-inflammatory responses: it neutralizes endotoxins…

Research base: 13 registered clinical trials and 28 indexed publications reference LL-37.

Safety considerations: No large-scale completed human safety trials for systemic therapeutic use; Endogenous peptide -- naturally produced; levels are tightly regulated in healthy tissue; Injection site reactions: redness, itching, swelling due to mild inflammatory properties and local immune cell recruitment (~5-10% of users).

Reviewed by the PeptideAtlas Editorial Team. Last reviewed: 2026-08-12.

Related peptides: Beta-Defensins, Alpha-Defensins, Lactoferricin.

Compare: LL-37 vs Beta-Defensins, LL-37 vs Alpha-Defensins, LL-37 vs Lactoferricin.

Frequently asked questions

Is LL-37 naturally produced by the body?

Yes. LL-37 is produced by epithelial cells, neutrophils, and other immune cells as part of the innate immune response. Vitamin D stimulates its endogenous production, which is one reason vitamin D status is linked to immune function.

How is LL-37 typically dosed in research?

Injectable research protocols typically use 100-200 mcg per injection SC, 1-3 times per week, cycling 2-4 weeks on with an equal break. Topical applications use 0.5-1% concentrations. Lower doses are safer and more physiologically mimetic of native cathelicidin responses.

Can LL-37 worsen autoimmune conditions?

Potentially yes. LL-37 can stimulate dendritic cells and inflammasomes (via P2X7 receptor), which could worsen symptoms in individuals with autoimmune predispositions or chronic inflammatory conditions. Systemic use should be avoided without medical oversight in these patients.

Does LL-37 work against biofilms?

Yes. LL-37 has demonstrated anti-biofilm activity in addition to its direct antimicrobial effects, making it of particular interest for chronic wound infections where biofilms are a major barrier to healing.

Has LL-37 been tested in humans?

A randomized controlled trial evaluated topical LL-37 in venous leg ulcers. Systemic injectable use has not been evaluated in large clinical trials. Most evidence comes from preclinical studies and ex vivo human tissue experiments.