Lactoferricin vs LL-37

Compare Lactoferricin (evidence D) and LL-37 (evidence D) on mechanism, clinical status, safety, and dosing.

Lactoferricin is a 25-amino-acid antimicrobial peptide (f17-41 of bovine lactoferrin; MW ~3126 g/mol for bovine form) generated by pepsin digestion of…

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with…

Full profiles: Lactoferricin, LL-37.