Compare Beta-Defensins (evidence D) and LL-37 (evidence D) on mechanism, clinical status, safety, and dosing.
Beta-defensins are a family of small cationic antimicrobial peptides (36-45 amino acids, MW ~4-5 kDa) produced by epithelial cells throughout the body. The…
LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with…
Full profiles: Beta-Defensins, LL-37.