Alpha-Defensins vs LL-37

Compare Alpha-Defensins (evidence D) and LL-37 (evidence D) on mechanism, clinical status, safety, and dosing.

Alpha-defensins are a family of small cationic antimicrobial peptides (29-35 amino acids, MW ~3.5-4.5 kDa) with three characteristic intramolecular disulfide…

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with…

Full profiles: Alpha-Defensins, LL-37.